PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c11_5410V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 420aa    MW: 46384.3 Da    PI: 7.1656
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c11_5410V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.8e-171764148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WTt+Ed +lv +++++G g+W+  ++  g++R++k+c++rw +yl
  Pp3c11_5410V3.2.p 17 KGPWTTDEDRKLVAYIQEHGHGSWRVLPKNAGLTRCGKSCRLRWTNYL 64
                       79********************************************97 PP

2Myb_DNA-binding55.11.8e-1770114147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rgr+++ Ed+ +v+++  lG++ W+tIa++++ gRt++++k++w+++
  Pp3c11_5410V3.2.p  70 RGRFSEAEDQTIVHLHSVLGNR-WSTIAAHLP-GRTDNEIKNYWNTH 114
                        89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6871264IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-221467IPR009057Homeodomain-like
SuperFamilySSF466896.47E-3015111IPR009057Homeodomain-like
SMARTSM007174.8E-141666IPR001005SANT/Myb domain
PfamPF002497.5E-161764IPR001005SANT/Myb domain
CDDcd001673.15E-111964No hitNo description
PROSITE profilePS5129426.43965119IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2668119IPR009057Homeodomain-like
SMARTSM007174.4E-1669117IPR001005SANT/Myb domain
PfamPF002493.8E-1570114IPR001005SANT/Myb domain
CDDcd001671.35E-1172115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MGRAPGNGDE KEGTLRKGPW TTDEDRKLVA YIQEHGHGSW RVLPKNAGLT RCGKSCRLRW  60
TNYLRPDIKR GRFSEAEDQT IVHLHSVLGN RWSTIAAHLP GRTDNEIKNY WNTHVKKRLL  120
QLGIDPLTHT ARIATDLVHE GADMKRSVSS NLCHISQWDV VRMETETRLF STTSLNNQTA  180
VGDIDRPPSS LYDPGEALQQ APPRHATSSS WKSSVATHSA RPALGDSNEA AYSDLQNVFR  240
GKESSSHSSA SPGNLYGTCE DIPAKSRSTS NHGSSLDNYH SSVSSTIISS KFLNPMSPTS  300
VLCPRSNSAG VLWDINLCSS FWQTQAAQLP MKADAQSFRE TSSNYEQGQL LHEPHLEVGY  360
DDSSELESTL RYLLLENSHN FNNLVDFAHS SSQTSCKPSA VCNLRAAPQY IDVHVLDSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29151195108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S389_41V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.13e-72myb domain protein 16